powered by:
Protein Alignment CG45011 and Spink2
DIOPT Version :9
Sequence 1: | NP_001285848.1 |
Gene: | CG45011 / 19835723 |
FlyBaseID: | FBgn0266363 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001008870.1 |
Gene: | Spink2 / 408234 |
RGDID: | 1302956 |
Length: | 86 |
Species: | Rattus norvegicus |
Alignment Length: | 60 |
Identity: | 18/60 - (30%) |
Similarity: | 25/60 - (41%) |
Gaps: | 8/60 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 VLTEAQVTRPLC------PCPRIYFPVCGSDHVTYTNSCEL--KCAAQIKLIYVVKAGRC 67
::..:|...|.| .|.:...||||:|..||.|.|.| |.......|.::|...|
Rat 27 LIKRSQFRTPDCHRFDYPVCSKHLSPVCGTDMNTYGNECTLCMKIREDGSHINIIKDEPC 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000146 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X147 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.