DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45011 and Spink2

DIOPT Version :9

Sequence 1:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_001008870.1 Gene:Spink2 / 408234 RGDID:1302956 Length:86 Species:Rattus norvegicus


Alignment Length:60 Identity:18/60 - (30%)
Similarity:25/60 - (41%) Gaps:8/60 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VLTEAQVTRPLC------PCPRIYFPVCGSDHVTYTNSCEL--KCAAQIKLIYVVKAGRC 67
            ::..:|...|.|      .|.:...||||:|..||.|.|.|  |.......|.::|...|
  Rat    27 LIKRSQFRTPDCHRFDYPVCSKHLSPVCGTDMNTYGNECTLCMKIREDGSHINIIKDEPC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 15/47 (32%)
Spink2NP_001008870.1 KAZAL_FS 44..86 CDD:381802 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000146
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X147
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.