DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45011 and Spink8

DIOPT Version :9

Sequence 1:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_001100330.1 Gene:Spink8 / 301016 RGDID:1307150 Length:101 Species:Rattus norvegicus


Alignment Length:91 Identity:26/91 - (28%)
Similarity:36/91 - (39%) Gaps:31/91 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IALCLLAFVVLTEAQV-----------------TRPLC-----PCPRI-YF----PVCGSDHVTY 44
            :|:.:||..|.|...|                 |:.||     .|..: ||    |:|||:.|||
  Rat     7 VAVLVLAISVWTSFAVDFFLPMGFHTTEELLKETKALCVKNVQMCWILTYFKLSEPICGSNQVTY 71

  Fly    45 TNSCELKCAA---QIKLIYVVKAGRC 67
            ...|.| |:.   :.:.|..|..|.|
  Rat    72 NGECHL-CSEILFEDRTIIKVHDGPC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 17/52 (33%)
Spink8NP_001100330.1 KAZAL_PSTI 47..96 CDD:238648 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D647847at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.