DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45011 and CG44008

DIOPT Version :9

Sequence 1:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster


Alignment Length:75 Identity:32/75 - (42%)
Similarity:43/75 - (57%) Gaps:13/75 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IFIALCLLAFVVL-------TEAQVTRPLCPCPRIYFPVCGSDHVTYTNSCELKCA-----AQIK 57
            |.:|||||..:.:       || :|.||:|||||.|.|||||:.|||.|.||..|.     .|.:
  Fly     6 ILVALCLLLALTISPISCDDTE-KVVRPICPCPRNYEPVCGSNLVTYPNRCEFDCVRRNVERQGR 69

  Fly    58 LIYVVKAGRC 67
            .:.:::.|.|
  Fly    70 SMGLLRDGTC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 20/44 (45%)
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 18/42 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5415
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136310at33392
OrthoFinder 1 1.000 - - FOG0000146
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X147
54.970

Return to query results.
Submit another query.