powered by:
Protein Alignment CG45011 and LOC102547035
DIOPT Version :9
Sequence 1: | NP_001285848.1 |
Gene: | CG45011 / 19835723 |
FlyBaseID: | FBgn0266363 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006254888.1 |
Gene: | LOC102547035 / 102547035 |
RGDID: | 7509835 |
Length: | 91 |
Species: | Rattus norvegicus |
Alignment Length: | 36 |
Identity: | 15/36 - (41%) |
Similarity: | 23/36 - (63%) |
Gaps: | 4/36 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 PVCGSDHVTYTNSCELKCAAQIKL---IYVVKAGRC 67
|:|.|::|||.||| :.|.|.|.| :.:..:|:|
Rat 52 PLCASNNVTYPNSC-VYCFANIALDLTLQIQYSGKC 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG45011 | NP_001285848.1 |
KAZAL |
27..67 |
CDD:197624 |
14/34 (41%) |
LOC102547035 | XP_006254888.1 |
KAZAL_FS |
39..86 |
CDD:294071 |
14/34 (41%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1636538at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.