DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45011 and spink2.3

DIOPT Version :9

Sequence 1:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster
Sequence 2:XP_005157264.1 Gene:spink2.3 / 101882741 ZFINID:ZDB-GENE-141216-190 Length:76 Species:Danio rerio


Alignment Length:77 Identity:24/77 - (31%)
Similarity:33/77 - (42%) Gaps:11/77 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYSPIFIALCLLAFVVLTEAQVTRPLC------PCPRIYFPVCGSDHVTYTNSCELKCA----AQ 55
            |.:.|.:.|.|.|.....:...:.|.|      .|...|.||||:|..||.|.|.| |.    .:
Zfish     1 MLAQIVLLLSLAAMATAADDCPSVPNCGKYHLPACTMDYRPVCGTDGNTYGNECVL-CGNIFKEK 64

  Fly    56 IKLIYVVKAGRC 67
            :.:|.:.|.|.|
Zfish    65 LNIILISKKGEC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 17/49 (35%)
spink2.3XP_005157264.1 KAZAL_FS 31..76 CDD:294071 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000146
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X147
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.