powered by:
Protein Alignment CG45011 and Spink10
DIOPT Version :9
Sequence 1: | NP_001285848.1 |
Gene: | CG45011 / 19835723 |
FlyBaseID: | FBgn0266363 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002728606.3 |
Gene: | Spink10 / 100361300 |
RGDID: | 2320365 |
Length: | 160 |
Species: | Rattus norvegicus |
Alignment Length: | 45 |
Identity: | 13/45 - (28%) |
Similarity: | 23/45 - (51%) |
Gaps: | 12/45 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 CPRIYFPVCGSDHVTYTNSCELKCAA-----------QIKLIYVV 62
|.:.|:|:|.::..||.|.| :.|.| .||:|:::
Rat 47 CTKEYYPMCATNGQTYCNKC-IFCNALKLDKMPSSSLWIKIIFIL 90
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG45011 | NP_001285848.1 |
KAZAL |
27..67 |
CDD:197624 |
13/45 (29%) |
Spink10 | XP_002728606.3 |
KAZAL_FS |
37..>71 |
CDD:294071 |
9/24 (38%) |
Kazal_1 |
114..157 |
CDD:278479 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1636538at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.