powered by:
Protein Alignment CG45011 and si:ch211-195b11.3
DIOPT Version :9
Sequence 1: | NP_001285848.1 |
Gene: | CG45011 / 19835723 |
FlyBaseID: | FBgn0266363 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001278829.1 |
Gene: | si:ch211-195b11.3 / 100334344 |
ZFINID: | ZDB-GENE-141222-6 |
Length: | 73 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 22/67 - (32%) |
Similarity: | 38/67 - (56%) |
Gaps: | 5/67 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 IFIALCLLAFVVLTEAQVT--RPLCPCPRIYFPVCGSDHVTYTNSCELKCAAQIK--LIYVVKAG 65
|.:.:.::.::.:.||:.| .|:. |.|.|.||||.|.:||:|.|.|:..:..| ::.|...|
Zfish 5 ILVCVSVVFYLTMVEAEATDESPIV-CTREYKPVCGDDGITYSNECMLRWESNAKEVVVNVKHEG 68
Fly 66 RC 67
:|
Zfish 69 KC 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG45011 | NP_001285848.1 |
KAZAL |
27..67 |
CDD:197624 |
16/41 (39%) |
si:ch211-195b11.3 | NP_001278829.1 |
KAZAL |
27..70 |
CDD:197624 |
17/43 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000146 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto40949 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X147 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.