powered by:
Protein Alignment CG45011 and Gm10267
DIOPT Version :9
Sequence 1: | NP_001285848.1 |
Gene: | CG45011 / 19835723 |
FlyBaseID: | FBgn0266363 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001268399.1 |
Gene: | Gm10267 / 100042855 |
MGIID: | 3642556 |
Length: | 85 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 19/68 - (27%) |
Similarity: | 32/68 - (47%) |
Gaps: | 15/68 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MYSPIFIALCLLAFVVLTEAQVTR-------PLCP-------CPRIYFPVCGSDHVTYTNSCELK 51
::|.:.:....|:|::.:|:...| .:|. |.|.|||||.::..||.|.| :.
Mouse 3 IFSRVQVIYITLSFLLCSESHFIRRAIYKHIVMCRGFSSKRICTREYFPVCATNGRTYFNKC-IF 66
Fly 52 CAA 54
|.|
Mouse 67 CLA 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG45011 | NP_001285848.1 |
KAZAL |
27..67 |
CDD:197624 |
14/35 (40%) |
Gm10267 | NP_001268399.1 |
Kazal_1 |
41..85 |
CDD:278479 |
13/30 (43%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1636538at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.