DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45011 and Spink13

DIOPT Version :9

Sequence 1:NP_001285848.1 Gene:CG45011 / 19835723 FlyBaseID:FBgn0266363 Length:67 Species:Drosophila melanogaster
Sequence 2:XP_006525523.2 Gene:Spink13 / 100038417 MGIID:3642511 Length:137 Species:Mus musculus


Alignment Length:87 Identity:24/87 - (27%)
Similarity:35/87 - (40%) Gaps:32/87 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLAFVVLTEAQVT------------RPLCPCPRIYFP---------------VCGSDHVTYTNSC 48
            ||:.|:||...||            .|..|| ::|:|               ||.::.:||.|.|
Mouse    52 LLSLVLLTWTHVTFSALIRSHNFSRWPKPPC-KMYYPIDPDYEANCPDVKAYVCATNGLTYKNEC 115

  Fly    49 ELKCAAQIKL---IYVVKAGRC 67
             ..|..:.:.   |..||.|:|
Mouse   116 -FFCIDRWEFGPHIQFVKYGKC 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45011NP_001285848.1 KAZAL 27..67 CDD:197624 15/57 (26%)
Spink13XP_006525523.2 KAZAL 95..136 CDD:197624 11/41 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.