DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45072 and CG45073

DIOPT Version :9

Sequence 1:NP_001287600.1 Gene:CG45072 / 19835597 FlyBaseID:FBgn0266442 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001287601.1 Gene:CG45073 / 19836197 FlyBaseID:FBgn0266443 Length:271 Species:Drosophila melanogaster


Alignment Length:273 Identity:61/273 - (22%)
Similarity:115/273 - (42%) Gaps:86/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ESEQEEGPEKL-----AKQHGSRPHPGQGFKLISFDAVGKHIALGLDYLVPFLEVPVKRKRNAPP 84
            |..|:.|...:     |:::..:...|:||   .|.|.|:.:::.::::||||:|||||..|...
  Fly    51 EPRQQSGRMDVELDLDAEENAGQDREGRGF---HFHASGEDVSVEMEFIVPFLKVPVKRSMNLAR 112

  Fly    85 KPL---------VVVNSAAVVSCGLVVAGGVLVGHLIRSLGLEAITGDDQHPIFGNSSTHKPKSS 140
            ..:         .:||:|.||:.|.::||  :|..||..|.:.::         ||...:|    
  Fly   113 DAIQSILNLRTGALVNTAVVVAAGAIIAG--VVRLLIAPLVITSL---------GNGYGYK---- 162

  Fly   141 EEEGSSSTPAPKNSTNATARGLFDDNLSFPGILDNFKLIYRNETGDRVATNLPNILGMIERTFLK 205
                                       ::|               ||....|.::   :|....:
  Fly   163 ---------------------------TYP---------------DRSMRRLTDV---VESHLEE 182

  Fly   206 NDVDLTVCLLKSICTLTHNAGEKVSKGQASDFEHLLDGATKWSWLLAWLDQSAFRDAIEAGKSNV 270
            :::|::||:.:.||       :.:.:..:|.:...|:..|..:||.:.:|.:|...||::.||: 
  Fly   183 HNIDMSVCVQRMIC-------QYLQQNLSSGYARALNILTSSAWLHSIVDGTAVFHAIQSAKSS- 239

  Fly   271 PHHCAIKYPECKW 283
             ..|:..|..|||
  Fly   240 -RTCSHTYRSCKW 251



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.