DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45065 and CHDH

DIOPT Version :9

Sequence 1:NP_001285251.1 Gene:CG45065 / 19835504 FlyBaseID:FBgn0266435 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_060867.2 Gene:CHDH / 55349 HGNCID:24288 Length:594 Species:Homo sapiens


Alignment Length:586 Identity:219/586 - (37%)
Similarity:306/586 - (52%) Gaps:76/586 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RRQYDFVVIGGGSAGAVVANRLSEVRNWTVLLLEAGGDETEISDVPALAGYLQLTELDWKYQTTP 105
            |.:|.:||:|.||||.|:|.||:|.....|||||||..:       .|||..:|:   ||.....
Human    38 RDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKD-------VLAGSKRLS---WKIHMPA 92

  Fly   106 SSTRQYC-------------QAMKGDRCFWPRGKVLGGSSVLNAMVYVRGSKNDYNHWASLGNPG 157
            :.....|             :.:.|...:||||:|.||||.|||||||||...||..|...|..|
Human    93 ALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARG 157

  Fly   158 WDYDSMLKYFLKSEDVRNPYLAKTPYHETGGYLTVQEAPWRTPLSIAFLQAGIEMGYE-NRDING 221
            |||...|.||.|::   ...|..:.|....|.|.|.......||..|||:|..:.||. ..|:||
Human   158 WDYAHCLPYFRKAQ---GHELGASRYRGADGPLRVSRGKTNHPLHCAFLEATQQAGYPLTEDMNG 219

  Fly   222 AQQTGFMLTQSTIRRGARCSTGKAFIRPVRQRKNFDVLLHAEA----TRILFDKQKRAIGVEYMR 282
            .||.||.....||..|.|.|...|::.|...|.|    |.|||    :|:||: ..||:||||::
Human   220 FQQEGFGWMDMTIHEGKRWSAACAYLHPALSRTN----LKAEAETLVSRVLFE-GTRAVGVEYVK 279

  Fly   283 GGRKNVVFVRREVIASAGALNTPKLLMLSGVGPAEHLQEHNIPVISDLP-VGNNMQDHVGLGGLT 346
            .|:.:..:..:|||.|.||:|:|:||||||:|.|:.|::..|||:..|| ||.|:|||:.:    
Human   280 NGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEI---- 340

  Fly   347 FVVDA---PLTV--TRNRFQTIPVSMEYILRERGPMTFSGVEGVAFLNTKYQDPSVDWPDVQFHF 406
            ::..|   |:|:  .:...:.:.:.:|::.:..|....:.:|...|:.::   |.|..||:||||
Human   341 YIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQ---PGVPHPDIQFHF 402

  Fly   407 CPSSINSDGGEQIRKILNLRDGFYNTVYKPLQHSETWSILPLLLRPKSTGWVRLNSRNPQHQPKI 471
            .||.:...|                  ..|.| .|.:.:....:|..|.||::|.|.|||..|.|
Human   403 LPSQVIDHG------------------RVPTQ-QEAYQVHVGPMRGTSVGWLKLRSANPQDHPVI 448

  Fly   472 IPNYFAHQEDIDVLVEGIKLAINVSNTQAFQRF-GSRLHNIPLPGCRHLPFQSNEYWACCIKEFT 535
            .|||.:.:.||:.....:||...:...:|...| |..|.    || .|:  ||::.....::...
Human   449 QPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQ----PG-SHI--QSDKEIDAFVRAKA 506

  Fly   536 FTIYHPAGTCRMGPSWDVTAVVDPRLRVYGVSGVRVVDASIMPTIVNGNPNAPVIAIGEKASDLI 600
            .:.|||:.||:||...|.||||||:.||.||..:|||||||||::|:||.|||.|.|.|||:|:|
Human   507 DSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADII 571

  Fly   601 K 601
            |
Human   572 K 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45065NP_001285251.1 PRK02106 42..601 CDD:235000 216/583 (37%)
NADB_Rossmann 117..339 CDD:304358 100/227 (44%)
GMC_oxred_C 452..596 CDD:282984 62/144 (43%)
CHDHNP_060867.2 PRK02106 40..594 CDD:235000 218/584 (37%)
NADB_Rossmann 44..>149 CDD:304358 47/114 (41%)
NADB_Rossmann 116..339 CDD:304358 102/230 (44%)
GMC_oxred_C 430..567 CDD:282984 62/143 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2506
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I2510
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52181
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000165
OrthoInspector 1 1.000 - - otm40396
orthoMCL 1 0.900 - - OOG6_100146
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3702
SonicParanoid 1 1.000 - - X135
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.