DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45065 and Gld

DIOPT Version :9

Sequence 1:NP_001285251.1 Gene:CG45065 / 19835504 FlyBaseID:FBgn0266435 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001350861.1 Gene:Gld / 40875 FlyBaseID:FBgn0001112 Length:625 Species:Drosophila melanogaster


Alignment Length:589 Identity:245/589 - (41%)
Similarity:352/589 - (59%) Gaps:53/589 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QYDFVVIGGGSAGAVVANRLSEVRNWTVLLLEAGGDETEISDVPALAGYLQL--TELDWKYQTTP 105
            :|||:||||||||:|||:|||||..|.|||:||||||...:.:|::  :|..  :::|::|.|.|
  Fly    64 EYDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSM--FLNFIGSDIDYRYNTEP 126

  Fly   106 SSTRQYCQAMKGDRCFWPRGKVLGGSSVLNAMVYVRGSKNDYNHWASLGNPGWDYDSMLKYFLKS 170
            ..  ..|.:....||:|||||||||:||||.|:||||::.||:.||:.|||||.|:.:|.:|.||
  Fly   127 EP--MACLSSMEQRCYWPRGKVLGGTSVLNGMMYVRGNREDYDDWAADGNPGWAYNDVLPFFKKS 189

  Fly   171 EDVRNPYLAKTPYHETGGYLTVQEAPWRTPLSIAFLQAGIEMGYENRDINGAQQTGFMLTQSTIR 235
            ||..:.....|.||..||.|.|.:.|:..|||.|.|:||.|:|:...|:||...||||:.|.|.|
  Fly   190 EDNLDLDEVGTEYHAKGGLLPVGKFPYNPPLSYAILKAGEELGFSVHDLNGQNSTGFMIAQMTAR 254

  Fly   236 RGARCSTGKAFIRPVRQRKNFDVLLHAEATRILFDKQ-KRAIGVEYM-RGGRKNVVFVRREVIAS 298
            .|.|.|:.:||:||.|.|.|..:||:..||:||.... |..:|||.. :.|....:.|::||:.|
  Fly   255 NGIRYSSARAFLRPARMRNNLHILLNTTATKILIHPHTKNVLGVEVSDQFGSTRKILVKKEVVLS 319

  Fly   299 AGALNTPKLLMLSGVGPAEHLQEHNIPVISDLP-VGNNMQDHVGLGGLTFVVDAPLTVTRNRFQT 362
            |||:|:|.:|:||||||.:.||:.|:..:.:|| ||.|:.:||......|:.||         .|
  Fly   320 AGAVNSPHILLLSGVGPKDELQQVNVRTVHNLPGVGKNLHNHVTYFTNFFIDDA---------DT 375

  Fly   363 IPV----SMEYILRERGPMTFSGVEGV-AFLNTKYQDPSVDWPDVQFHFCPSSINSDGG------ 416
            .|:    :|||:|...|.|:.:|:..| |.|.|:|.| |.:.||:|.:|        ||      
  Fly   376 APLNWATAMEYLLFRDGLMSGTGISDVTAKLATRYAD-SPERPDLQLYF--------GGYLASCA 431

  Fly   417 --EQIRKILNLRDGFYNTVYKPLQHSETWSILPLLLRPKSTGWVRLNSRNPQHQPKIIPNYFAHQ 479
              .|:.::|:             .:|.:..|.|.:|.|:|.|::.|.|.:|...|:|:.||..|:
  Fly   432 RTGQVGELLS-------------NNSRSIQIFPAVLNPRSRGFIGLRSADPLEPPRIVANYLTHE 483

  Fly   480 EDIDVLVEGIKLAINVSNTQAFQRFGSRLHNIPLPGCRHLPFQSNEYWACCIKEFTFTIYHPAGT 544
            :|:..||||||..|.:|.|...:::|.||....:.||....|.|:.||.|.:::.|....|.||:
  Fly   484 QDVKTLVEGIKFVIRLSQTTPLKQYGMRLDKTVVKGCEAHAFGSDAYWECAVRQNTGPENHQAGS 548

  Fly   545 CRMGPSWDVTAVVDPRLRVYGVSGVRVVDASIMPTIVNGNPNAPVIAIGEKASDLIKEDWGVRRA 609
            |:||||.|..|||:..|||:|:.|:||:|.||||.:.:||.:||.:.|.||.:.|:|..||.:..
  Fly   549 CKMGPSHDPMAVVNHELRVHGIRGLRVMDTSIMPKVSSGNTHAPAVMIAEKGAYLLKRAWGAKVX 613

  Fly   610 HTSA 613
            ...|
  Fly   614 RVDA 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45065NP_001285251.1 PRK02106 42..601 CDD:235000 241/575 (42%)
NADB_Rossmann 117..339 CDD:304358 108/224 (48%)
GMC_oxred_C 452..596 CDD:282984 62/143 (43%)
GldNP_001350861.1 Pyr_redox_dim 29..>95 CDD:332164 23/30 (77%)
GMC_oxred_C 64..601 CDD:331873 240/571 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I2249
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1608
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000165
OrthoInspector 1 1.000 - - otm24368
orthoMCL 1 0.900 - - OOG6_100146
Panther 1 1.100 - - P PTHR11552
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X135
87.960

Return to query results.
Submit another query.