DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and PMA2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_015289.1 Gene:PMA2 / 856071 SGDID:S000005957 Length:947 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:45/184 - (24%)
Similarity:74/184 - (40%) Gaps:41/184 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LEANVSQGLTSEAAGRKLARNGKNVLPLPTKLELRPWIFLKSCFSILGII--------ILLSSIA 113
            |..:.:.||||:...|:..:.|.|.:     .|....:.:|.....:|.|        ||.:.::
Yeast   109 LSTDPAYGLTSDEVARRRKKYGLNQM-----AEENESLIVKFLMFFVGPIQFVMEAAAILAAGLS 168

  Fly   114 SFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDEL---MPMYC 175
            .:.          |.|.:....|:...:..:..|.||..|              |||   :....
Yeast   169 DWV----------DVGVICALLLLNASVGFIQEFQAGSIV--------------DELKKTLANTA 209

  Fly   176 TVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFS-TTGLELNNVALTGHS 228
            ||||||:...|...::|||:.|.::.|...|||.|..: ...|:::..|:||.|
Yeast   210 TVIRDGQLIEIPANEVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGES 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 14/67 (21%)
E1-E2_ATPase 140..>230 CDD:278548 28/93 (30%)
PMA2NP_015289.1 P-type_ATPase_H 116..903 CDD:319771 44/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.