DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and PMA1

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_011507.1 Gene:PMA1 / 852876 SGDID:S000002976 Length:918 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:45/190 - (23%)
Similarity:78/190 - (41%) Gaps:53/190 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LEANVSQGLTSEAAGRKLARNGKNVLPLPTKLELRPWIFLKSCFSILGII--------ILLSSIA 113
            |:.:.|.||||:...::..:.|.|.:     .:.:..:.:|.....:|.|        ||.:.::
Yeast    80 LQTDPSYGLTSDEVLKRRKKYGLNQM-----ADEKESLVVKFVMFFVGPIQFVMEAAAILAAGLS 139

  Fly   114 SFAMYYLFATKTPDNGKVDPEFLVAGIILL------VTFFLAGLTVQMQGDDDEDMLIAFDEL-- 170
            .:.          |.|      ::.|:::|      |..|.||..|              |||  
Yeast   140 DWV----------DFG------VICGLLMLNAGVGFVQEFQAGSIV--------------DELKK 174

  Fly   171 -MPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFS-TTGLELNNVALTGHS 228
             :.....|||||:...|...::||||.|.::.|..:|.|.|..: ...|:::..|:||.|
Yeast   175 TLANTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGES 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 13/67 (19%)
E1-E2_ATPase 140..>230 CDD:278548 29/99 (29%)
PMA1NP_011507.1 P-type_ATPase_H 87..874 CDD:319771 43/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S851
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.