DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and CCC2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_010556.1 Gene:CCC2 / 851862 SGDID:S000002678 Length:1004 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:41/203 - (20%)
Similarity:80/203 - (39%) Gaps:64/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VLPL--PTKLELRPWIFLKSCF-------SILGIIILLSSIASFAMYYLF-----ATKTPDNGKV 131
            ::|:  ||.::.|.:.:.::.|       .|||:|  |:|...|::.:.|     |:....:|.:
Yeast   274 IVPMMWPTIVQDRIFPYKETSFVRGLFYRDILGVI--LASYIQFSVGFYFYKAAWASLKHGSGTM 336

  Fly   132 D-------------------------------PEFLVAGIILLVTFFLAGLTVQ-MQGDDDEDML 164
            |                               |..:....|:::::...|..:: :........|
Yeast   337 DTLVCVSTTCAYTFSVFSLVHNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTAL 401

  Fly   165 IAFDELMPMYCTVIRDGEK--------EVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTG-LELN 220
            ....:|.|..|::|.|.|:        |:::..|:|     .||.|.::|||  ...|.| .|::
Yeast   402 SKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIV-----EIKPGMKIPAD--GIITRGESEID 459

  Fly   221 NVALTGHS 228
            ...:||.|
Yeast   460 ESLMTGES 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 12/44 (27%)
E1-E2_ATPase 140..>230 CDD:278548 24/99 (24%)
CCC2NP_010556.1 HMA 6..67 CDD:238219
HMA 84..144 CDD:238219
P-type_ATPase_Cu-like 259..938 CDD:319783 41/203 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.