DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ENA1

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_010325.1 Gene:ENA1 / 851610 SGDID:S000002447 Length:1091 Species:Saccharomyces cerevisiae


Alignment Length:193 Identity:51/193 - (26%)
Similarity:93/193 - (48%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVLPLPTKLELRPWIFLKSCFSILGI 105
            |:.| |.....|....:..::::|||.:....:|...|:|.|...||::.:..:..:.|.::: :
Yeast    14 FNAY-HTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMI-M 76

  Fly   106 IILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGII--LLVTFFLAGLTVQMQGDDDEDMLIAFD 168
            ::|:|.|.||||:               :::..|:|  ::....|.||..:.:.....:.|   .
Yeast    77 VLLISMIISFAMH---------------DWITGGVISFVIAVNVLIGLVQEYKATKTMNSL---K 123

  Fly   169 ELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNVALTGHSKPM 231
            .|......|||:|:.|.|.::|:||||...:|.|..:|||:|...|...:.:...|||.|.|:
Yeast   124 NLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 17/70 (24%)
E1-E2_ATPase 140..>230 CDD:278548 28/91 (31%)
ENA1NP_010325.1 ATPase-IID_K-Na 11..1055 CDD:130586 51/193 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.