DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and atp2c2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001072524.1 Gene:atp2c2 / 779979 XenbaseID:XB-GENE-5873516 Length:1017 Species:Xenopus tropicalis


Alignment Length:186 Identity:47/186 - (25%)
Similarity:88/186 - (47%) Gaps:29/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HELCARLEANVSQGLTSEAAGRKLARNG------KNVLPLPTKLELRPWIFLKSCFSILGIIILL 109
            :||...|:.:|..||:..:..::..::.      .|..|:..|       :|....:.|.:::|.
 Frog   136 NELVKYLQVDVESGLSECSVLQRRIKHSWNEFQVDNTDPIWKK-------YLGQFTNPLILLLLG 193

  Fly   110 SSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMY 174
            |::.|      ..||..:    |...:...|:::||      ...:|....|..|...::|:|..
 Frog   194 SALVS------IITKEYE----DAVSITVAILIVVT------VAFVQEYRSEKSLEELNKLVPPE 242

  Fly   175 CTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNVALTGHSKP 230
            |..||||:::.:..::|||||.:.:..|.|:|||:|...||.|.::..:.||.::|
 Frog   243 CNCIRDGKQQHLLARELVPGDVVCLSVGDRVPADIRLIETTDLLVDESSFTGETEP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 14/71 (20%)
E1-E2_ATPase 140..>230 CDD:278548 29/89 (33%)
atp2c2NP_001072524.1 P-type_ATPase_SPCA 158..998 CDD:319779 41/164 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.