DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp2c2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_081198.1 Gene:Atp2c2 / 69047 MGIID:1916297 Length:944 Species:Mus musculus


Alignment Length:197 Identity:52/197 - (26%)
Similarity:87/197 - (44%) Gaps:31/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ELCARLEANVSQGLTSEAAGRKLARNG------KNVLPLPTKLELRPWIFLKSCFSILGIIILLS 110
            ||......::..||:..|..::...:|      .|..|:..|       :|....:.|.:::|.|
Mouse    62 ELARAFHVDLDSGLSEFAVAQRRLVHGWNEFVTDNAEPVWKK-------YLDQFRNPLILLLLGS 119

  Fly   111 SIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYC 175
            |:.|      ..||..:    |...:...::::||   .|.   :|....|..|....:|:|..|
Mouse   120 SVVS------VLTKEYE----DAVSIALAVLIVVT---VGF---IQEYRSEKSLEELTKLVPPEC 168

  Fly   176 TVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNVALTGHSKPMHIT--PLAN 238
            ..:|||:...:..:||||||.:.:..|.|:|||:|....|.|.::..:.||..:|...|  |||:
Mouse   169 NCLRDGKLRHMLARDLVPGDIVSLSMGDRIPADIRLTEVTDLLVDESSFTGEVEPCGKTDSPLAD 233

  Fly   239 EG 240
            .|
Mouse   234 GG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 15/70 (21%)
E1-E2_ATPase 140..>230 CDD:278548 28/89 (31%)
Atp2c2NP_081198.1 ATPase-IIA2_Ca 54..929 CDD:130585 52/197 (26%)
Cation_ATPase_N 61..123 CDD:279080 14/67 (21%)
Interaction with ORAI1. /evidence=ECO:0000250|UniProtKB:O75185 69..93 4/23 (17%)
E1-E2_ATPase 135..366 CDD:278548 34/107 (32%)
Cation_ATPase 439..521 CDD:289987
COG4087 584..707 CDD:226572
Cation_ATPase_C 754..927 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.