Sequence 1: | NP_001286728.1 | Gene: | CG45063 / 19835490 | FlyBaseID: | FBgn0266433 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081198.1 | Gene: | Atp2c2 / 69047 | MGIID: | 1916297 | Length: | 944 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 52/197 - (26%) |
---|---|---|---|
Similarity: | 87/197 - (44%) | Gaps: | 31/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 ELCARLEANVSQGLTSEAAGRKLARNG------KNVLPLPTKLELRPWIFLKSCFSILGIIILLS 110
Fly 111 SIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYC 175
Fly 176 TVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNVALTGHSKPMHIT--PLAN 238
Fly 239 EG 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG45063 | NP_001286728.1 | Cation_ATPase_N | 46..117 | CDD:214842 | 15/70 (21%) |
E1-E2_ATPase | 140..>230 | CDD:278548 | 28/89 (31%) | ||
Atp2c2 | NP_081198.1 | ATPase-IIA2_Ca | 54..929 | CDD:130585 | 52/197 (26%) |
Cation_ATPase_N | 61..123 | CDD:279080 | 14/67 (21%) | ||
Interaction with ORAI1. /evidence=ECO:0000250|UniProtKB:O75185 | 69..93 | 4/23 (17%) | |||
E1-E2_ATPase | 135..366 | CDD:278548 | 34/107 (32%) | ||
Cation_ATPase | 439..521 | CDD:289987 | |||
COG4087 | 584..707 | CDD:226572 | |||
Cation_ATPase_C | 754..927 | CDD:279079 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167831021 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |