DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp13a3

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_038944543.1 Gene:Atp13a3 / 678704 RGDID:1590881 Length:1249 Species:Rattus norvegicus


Alignment Length:265 Identity:63/265 - (23%)
Similarity:106/265 - (40%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRWCRSRRKKKEERESLQQTENELWLEYFSPY---------LHIWPFHE------LCARLEANVS 62
            |...|...:.:.|.....|:::: .:.||:.:         :|.:.|.:      .||.:....|
  Rat   109 GHAVRLTEENRCEMNKYSQSQSQ-QMRYFTHHSIRYFWNDAIHNFDFLKGLDEGVSCASMYEKHS 172

  Fly    63 QGLTSEA-AGRKL-------ARNGKNVLPLPTKLELRPWIFLKSCFSILGIIILLSSIASFAMYY 119
            .|||... |.|||       |....:|..|..|..|.|: ::...||::        :.|...||
  Rat   173 AGLTKGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPF-YIFQLFSVI--------LWSIDEYY 228

  Fly   120 LFATKTPDNGKVDPEFLVAGIILLVTFFLAGL-TVQMQGDDDEDMLIAFDELMPMYCTVIRDGEK 183
            .:|              :|.:::.:...::.| :::.|.....||:.....:....|.|  :.|.
  Rat   229 YYA--------------LAIVVMSIVSIISSLYSIRKQYVMLHDMVATHSTVRVSVCRV--NEEI 277

  Fly   184 EVIRTQDLVPGDTLPIKY-GQRLPADMRFFSTTGLELNNVALTGHSKPMHITPLANE-------G 240
            |.|.:.||||||.:.|.. |..:|.|....:.|.: :|...|||.|.|:..|.|.|.       |
  Rat   278 EEIFSTDLVPGDVMIIPLNGTVMPCDAVLINGTCI-VNESMLTGESVPVTKTNLPNPSVDVKGMG 341

  Fly   241 RQRYS 245
            .::||
  Rat   342 EEQYS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 21/84 (25%)
E1-E2_ATPase 140..>230 CDD:278548 25/91 (27%)
Atp13a3XP_038944543.1 P-ATPase-V 14..1142 CDD:273738 63/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.