DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and atp1a3b

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571760.2 Gene:atp1a3b / 64611 ZFINID:ZDB-GENE-001212-8 Length:1023 Species:Danio rerio


Alignment Length:217 Identity:69/217 - (31%)
Similarity:110/217 - (50%) Gaps:13/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVL-PL 84
            |||:..:.|...:.|:.|..     |.....|:|.:.:.::.||||:..|...|||:|.|.| |.
Zfish    24 KKKKGAKDLDDLKKEVPLTE-----HKMSVEEVCRKFQTDIVQGLTNAKARDFLARDGPNALTPP 83

  Fly    85 PTKLELRPWI-FLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFL 148
            ||..|   |: |.:..|....|::.:.:|..|..|.:.|. |.|:...|..:|  ||:|.....:
Zfish    84 PTTPE---WVKFCRQLFGGFSILLWIGAILCFLAYAIQAA-TEDDPAGDNLYL--GIVLSAVVII 142

  Fly   149 AGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFS 213
            .|.....|......::.:|..::|....|||:|||..|..:::|.||.:.:|.|.|:|||:|..|
Zfish   143 TGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIIS 207

  Fly   214 TTGLELNNVALTGHSKPMHITP 235
            ..|.:::|.:|||.|:|...:|
Zfish   208 AHGCKVDNSSLTGESEPQTRSP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 24/72 (33%)
E1-E2_ATPase 140..>230 CDD:278548 30/89 (34%)
atp1a3bNP_571760.2 ATPase-IIC_X-K 25..1023 CDD:273445 68/216 (31%)
Cation_ATPase_N 41..114 CDD:214842 25/80 (31%)
E1-E2_ATPase 134..365 CDD:278548 32/96 (33%)
Cation_ATPase 427..521 CDD:289987
COG4087 606..>732 CDD:226572
Cation_ATPase_C 799..1008 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.