DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and atp13a2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001073506.1 Gene:atp13a2 / 568666 ZFINID:ZDB-GENE-061215-126 Length:1170 Species:Danio rerio


Alignment Length:262 Identity:62/262 - (23%)
Similarity:102/262 - (38%) Gaps:72/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KKEERESLQ-QTENELWLEY--FSPYLHIWPFHE-------------LCARLEANVSQGLTSEAA 70
            :.|.|:::| .:|.:..|.|  |....:||...:             .||.|... .|||:....
Zfish   124 ENEWRDTVQLHSEKKTLLRYYVFEGIRYIWISKKGAFCKASVLSEGWTCADLHGQ-QQGLSRADQ 187

  Fly    71 GRKLARNGKNVLPLPTKLELR--------PWIFLKSCFSILGIIILLSSIASFAMYYLFATKTPD 127
            ..:....|.|::.:|.|..|:        |:..    |.:..||:.:|   ...:||        
Zfish   188 STRKQIFGANIIDVPVKSYLQLLFEEVLNPFYI----FQVFSIILWMS---DGYVYY-------- 237

  Fly   128 NGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYC-----TVIRD-GEKEVI 186
                      |..|.:::....|:::.......       ..|..|.|     ||.|| ||:|.:
Zfish   238 ----------AACIFIISLISIGVSLYETRKQS-------TTLRRMACLIVNVTVRRDTGEEECV 285

  Fly   187 RTQDLVPGDTLPI-KYGQRLPADMRFFSTTGLELNNVALTGHSKPMHITPLAN-------EGRQR 243
            .:::|||||.:.| ..|..||.|....:...: :|...|||.|.|:..|||:|       |.::|
Zfish   286 SSEELVPGDCVVIPAEGLLLPCDAALVAGECM-VNESMLTGESIPVMKTPLSNSEATYNPESQRR 349

  Fly   244 YS 245
            ::
Zfish   350 HT 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 18/91 (20%)
E1-E2_ATPase 140..>230 CDD:278548 27/96 (28%)
atp13a2NP_001073506.1 P5-ATPase 36..152 CDD:289194 7/27 (26%)
P-ATPase-V 42..1102 CDD:273738 62/262 (24%)
Cation_ATPase_N <179..229 CDD:279080 12/53 (23%)
E1-E2_ATPase 241..478 CDD:278548 34/119 (29%)
Cation_ATPase <606..646 CDD:289987
HAD_like <832..885 CDD:304363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.