DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and atp2b2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001116710.1 Gene:atp2b2 / 557430 ZFINID:ZDB-GENE-061016-1 Length:1253 Species:Danio rerio


Alignment Length:221 Identity:50/221 - (22%)
Similarity:87/221 - (39%) Gaps:55/221 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LCARLEANVSQGLTSEAAGRKLARN--GKNVLPLPTKLELRPWIFLKSCFSIL-GIIILLSSIAS 114
            ||.||:.:.::||...|......:.  |:|::| |.|    |..||:..:..| .:.:::..||:
Zfish    53 LCQRLKTSPTEGLAGLATDLDKRKEVFGRNLIP-PKK----PKTFLQLVWEALQDVTLIILEIAA 112

  Fly   115 FAMYYLFATKTPDNGKVD----------------------PEFLVAGI-ILLVTFF--------L 148
            .....|...:.|..|..|                      ...|::.: ::|||.|        .
Zfish   113 LISLGLSFYQPPGEGNTDACGDAKAGAEDEGESEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQF 177

  Fly   149 AGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFS 213
            .||..:::.:..              ..|:|.|:...:...|::.||...||||..||||.....
Zfish   178 RGLQSRIEQEQK--------------FQVVRGGQVIQLPVADILVGDIAQIKYGDLLPADGVLIQ 228

  Fly   214 TTGLELNNVALTGHSKPMHITPLANE 239
            ...|:::..:|||.|.  |:...|::
Zfish   229 GNDLKIDESSLTGESD--HVRKAADK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 18/66 (27%)
E1-E2_ATPase 140..>230 CDD:278548 25/98 (26%)
atp2b2NP_001116710.1 ATPase-IIB_Ca 9..1096 CDD:273668 50/221 (23%)
Cation_ATPase_N 48..115 CDD:279080 18/66 (27%)
E1-E2_ATPase 191..499 CDD:278548 21/64 (33%)
Cation_ATPase 560..649 CDD:289987
HAD 657..840 CDD:289480
Cation_ATPase_C 914..1092 CDD:279079
ATP_Ca_trans_C 1137..1184 CDD:289209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.