DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ATP7A

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_000043.4 Gene:ATP7A / 538 HGNCID:869 Length:1500 Species:Homo sapiens


Alignment Length:187 Identity:33/187 - (17%)
Similarity:60/187 - (32%) Gaps:74/187 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 WIF-------LKSCFSILGIIILLSSIASF---------AMYYLFATKTPDNGKVDPEFLVAGII 141
            |.|       ||...:.:.::|:|::..:|         |||        :..||:|        
Human   729 WYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLIILLVAMY--------ERAKVNP-------- 777

  Fly   142 LLVTFFLAGLTVQMQGDDDEDMLIAF----------------------DELMPMYCTVIRDGEKE 184
              :|||           |...||..|                      ..|.....|::......
Human   778 --ITFF-----------DTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDN 829

  Fly   185 VIRTQDLVP------GDTLPIKYGQRLPADMRFFSTTGLELNNVALTGHSKPMHITP 235
            ::.:::.|.      ||.:.:..|.:.|.|.|......: ::...:||.:.|:...|
Human   830 ILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSM-VDESLITGEAMPVAKKP 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 7/39 (18%)
E1-E2_ATPase 140..>230 CDD:278548 18/117 (15%)
ATP7ANP_000043.4 HMA 11..73 CDD:238219
HMA 174..236 CDD:238219
HMA 280..337 CDD:238219
HMA 380..443 CDD:238219
HMA 492..554 CDD:238219
HMA 567..630 CDD:238219
P-type_ATPase_Cu-like 652..1388 CDD:319783 33/187 (18%)
Endocytosis signal. /evidence=ECO:0000250|UniProtKB:Q64430 1467..1468
PDZD11-binding 1486..1500
Endocytosis signal. /evidence=ECO:0000250|UniProtKB:Q64430 1487..1488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.