DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ATP4A

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_000695.2 Gene:ATP4A / 495 HGNCID:819 Length:1035 Species:Homo sapiens


Alignment Length:231 Identity:61/231 - (26%)
Similarity:105/231 - (45%) Gaps:21/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SRRKKK-----EERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARN 77
            |::||.     :.:|.|:..:.|:.:..     |.....||..:.:.:.::||::..|...|.|:
Human    27 SKKKKAGGGGGKRKEKLENMKKEMEIND-----HQLSVAELEQKYQTSATKGLSASLAAELLLRD 86

  Fly    78 GKNVLPLPTKLELRPWIFLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIIL 142
            |.|.|..|....    .::|....:.|.:..|..:|:......||.:..:......:.|...|.|
Human    87 GPNALRPPRGTP----EYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDNLYLAIAL 147

  Fly   143 LVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPA 207
            :....:.|.....|.....:::.:|..|:|...||||||:|..|....||.||.:.:|.|.|:||
Human   148 IAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRVPA 212

  Fly   208 DMRFFSTTGLELNNVALTGHSKPM-------HITPL 236
            |:|..:..|.:::|.:|||.|:|.       |.:||
Human   213 DIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 16/70 (23%)
E1-E2_ATPase 140..>230 CDD:278548 32/89 (36%)
ATP4ANP_000695.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 3/13 (23%)
H-K_ATPase_N 2..>22 CDD:312544
ATPase-IIC_X-K 43..1035 CDD:273445 57/215 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.