DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and atp2a1l

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_005156129.1 Gene:atp2a1l / 494489 ZFINID:ZDB-GENE-041229-2 Length:993 Species:Danio rerio


Alignment Length:203 Identity:50/203 - (24%)
Similarity:95/203 - (46%) Gaps:20/203 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ELCARLEANVSQGLTSEAAGRKLARNGKNVLPLPTKLELRPW-IFLKSCFSILGIIILLSSIASF 115
            |..|....:.:.||:.|...:.||:.|.|.||......:  | :.::....:|..|:||::..||
Zfish    11 ECLAYFSVSETTGLSPEQFKKNLAKYGYNELPAEEGKSI--WELIIEQFEDLLVRILLLAACISF 73

  Fly   116 AMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRD 180
            .:.:....:......|:| |::  :::|:...:.|:   .|..:.|..:.|..|..|....|.|.
Zfish    74 VLAWFEEGEETITAFVEP-FVI--LLILIANAVVGV---WQERNAESAIEALKEYEPEMGKVYRS 132

  Fly   181 GEKEV--IRTQDLVPGDTLPIKYGQRLPADMRF--FSTTGLELNNVALTG-------HSKPMHIT 234
            ..|.|  |:.:::||||.:.:..|.::|||:|.  ..:|.|.::...|||       |::|:...
Zfish   133 DRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITHIRSTTLRVDQSILTGESVSVIKHTEPVPDP 197

  Fly   235 PLANEGRQ 242
            ...|:.::
Zfish   198 RAVNQDKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 18/65 (28%)
E1-E2_ATPase 140..>230 CDD:278548 27/100 (27%)
atp2a1lXP_005156129.1 Cation_ATPase_N 4..72 CDD:279080 16/62 (26%)
ATPase-IIA1_Ca 53..986 CDD:273452 38/159 (24%)
E1-E2_ATPase 93..340 CDD:278548 29/118 (25%)
Cation_ATPase 419..525 CDD:289987
HAD <608..709 CDD:289480
Cation_ATPase_C 781..984 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.