Sequence 1: | NP_001286728.1 | Gene: | CG45063 / 19835490 | FlyBaseID: | FBgn0266433 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005156129.1 | Gene: | atp2a1l / 494489 | ZFINID: | ZDB-GENE-041229-2 | Length: | 993 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 50/203 - (24%) |
---|---|---|---|
Similarity: | 95/203 - (46%) | Gaps: | 20/203 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 ELCARLEANVSQGLTSEAAGRKLARNGKNVLPLPTKLELRPW-IFLKSCFSILGIIILLSSIASF 115
Fly 116 AMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRD 180
Fly 181 GEKEV--IRTQDLVPGDTLPIKYGQRLPADMRF--FSTTGLELNNVALTG-------HSKPMHIT 234
Fly 235 PLANEGRQ 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG45063 | NP_001286728.1 | Cation_ATPase_N | 46..117 | CDD:214842 | 18/65 (28%) |
E1-E2_ATPase | 140..>230 | CDD:278548 | 27/100 (27%) | ||
atp2a1l | XP_005156129.1 | Cation_ATPase_N | 4..72 | CDD:279080 | 16/62 (26%) |
ATPase-IIA1_Ca | 53..986 | CDD:273452 | 38/159 (24%) | ||
E1-E2_ATPase | 93..340 | CDD:278548 | 29/118 (25%) | ||
Cation_ATPase | 419..525 | CDD:289987 | |||
HAD | <608..709 | CDD:289480 | |||
Cation_ATPase_C | 781..984 | CDD:279079 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573934 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |