DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ATP2B2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_016861981.1 Gene:ATP2B2 / 491 HGNCID:815 Length:1272 Species:Homo sapiens


Alignment Length:209 Identity:52/209 - (24%)
Similarity:85/209 - (40%) Gaps:52/209 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LCARLEANVSQGLTSEAAGRKLARN--GKNVLPLPTKLELRPWIFLKSCFSILG----IIILLSS 111
            :|.||:.:..:||...|...:..:.  |:|.:| |.|    |..||:..:..|.    ||:.:::
Human    56 ICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIP-PKK----PKTFLQLVWEALQDVTLIILEIAA 115

  Fly   112 IASFAMYYLF---------ATK---TPDNGKVDPEFLVAGIIL-------LVTFF--------LA 149
            |.|..:.:..         ||.   ..|.|:.:..::....||       |||.|        ..
Human   116 IISLGLSFYHPPGEGNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR 180

  Fly   150 GLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFST 214
            ||..:::.:..              .||:|.|:...|...::|.||...:|||..||||..|...
Human   181 GLQSRIEQEQK--------------FTVVRAGQVVQIPVAEIVVGDIAQVKYGDLLPADGLFIQG 231

  Fly   215 TGLELNNVALTGHS 228
            ..|:::..:|||.|
Human   232 NDLKIDESSLTGES 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 19/69 (28%)
E1-E2_ATPase 140..>230 CDD:278548 29/104 (28%)
ATP2B2XP_016861981.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.