DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ATP2B1

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001353453.1 Gene:ATP2B1 / 490 HGNCID:814 Length:1249 Species:Homo sapiens


Alignment Length:225 Identity:57/225 - (25%)
Similarity:91/225 - (40%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LCARLEANVSQGLTSEAAG--RKLARNGKNVLPLPTKLELRPWIFLKSCFSILG----IIILLSS 111
            :|.:|:.:.::||:...|.  |:.|..|||.:| |.|    |..||:..:..|.    ||:.:::
Human    59 ICTKLKTSPNEGLSGNPADLERREAVFGKNFIP-PKK----PKTFLQLVWEALQDVTLIILEIAA 118

  Fly   112 IASFAMYYLFATKTPDN--------GKVDPE-----------FLVAGIILLVTFF--------LA 149
            |.|..:.: :.....||        |:.:.|           .|....::|||.|        ..
Human   119 IVSLGLSF-YQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQFR 182

  Fly   150 GLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFST 214
            ||..:::.:..              .||||.|:...|...|:..||...:|||..||||......
Human   183 GLQSRIEQEQK--------------FTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQG 233

  Fly   215 TGLELNNVALTGHS----KPMHITPLANEG 240
            ..|:::..:|||.|    |.:...||...|
Human   234 NDLKIDESSLTGESDHVKKSLDKDPLLLSG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 21/69 (30%)
E1-E2_ATPase 140..>230 CDD:278548 27/101 (27%)
ATP2B1NP_001353453.1 ATPase-IIB_Ca 15..1064 CDD:273668 57/225 (25%)
ATP_Ca_trans_C 1103..1178 CDD:403580
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.