DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atpalpha

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_732572.1 Gene:Atpalpha / 48971 FlyBaseID:FBgn0002921 Length:1041 Species:Drosophila melanogaster


Alignment Length:246 Identity:71/246 - (28%)
Similarity:118/246 - (47%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSRRK---KKEERESLQQTENELWLEY--FSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLAR 76
            :||||   |..::|:|...:.||.:::  .||       .||..|.:.:...||:...|...|.|
  Fly    35 KSRRKMPAKVNKKENLDDLKQELDIDFHKISP-------EELYQRFQTHPENGLSHAKAKENLER 92

  Fly    77 NGKNVLPLPTKLELRPWI-FLKSCFSILGIIILLSSIASFAMYYLFATKT----PDNGKVDPEFL 136
            :|.|.|..|.  :...|: |.|:.|....:::.:.:|..|..|.:.|:.:    .||       |
  Fly    93 DGPNALTPPK--QTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDN-------L 148

  Fly   137 VAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKY 201
            ..||:|.....:.|:....|......::.:|..::|.:.||||:|||..:|.:|||.||.:.:|:
  Fly   149 YLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKF 213

  Fly   202 GQRLPADMRFFSTTGLELNNVALTGHSKPM-------HITPLANEGRQRYS 245
            |.|:|||:|.......:::|.:|||.|:|.       |..||..:....:|
  Fly   214 GDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 18/71 (25%)
E1-E2_ATPase 140..>230 CDD:278548 31/89 (35%)
AtpalphaNP_732572.1 ATPase-IIC_X-K 45..1041 CDD:273445 66/236 (28%)
Cation_ATPase_N 58..132 CDD:214842 20/82 (24%)
E1-E2_ATPase 152..383 CDD:278548 36/113 (32%)
Cation_ATPase 445..539 CDD:289987
COG4087 <695..770 CDD:226572
Cation_ATPase_C 817..1025 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S851
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.