DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ATP12A

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001172014.1 Gene:ATP12A / 479 HGNCID:13816 Length:1045 Species:Homo sapiens


Alignment Length:234 Identity:67/234 - (28%)
Similarity:111/234 - (47%) Gaps:23/234 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVLPLP 85
            |||..:|..|:   ||.|:.     |.....||..:...::..||:|..|...|||:|.|.|..|
Human    42 KKKNHKEEFQK---ELHLDD-----HKLSNRELEEKYGTDIIMGLSSTRAAELLARDGPNSLTPP 98

  Fly    86 TKLELRPWI--FLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFL 148
            .:   .|.|  |||   .::|...:|..:.:|..:..:..:...:.......:..|.:|.:...|
Human    99 KQ---TPEIVKFLK---QMVGGFSILLWVGAFLCWIAYGIQYSSDKSASLNNVYLGCVLGLVVIL 157

  Fly   149 AGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFS 213
            .|:....|.....:::.:|::::|....||||.||:.|.::.||.||.:.:|.|.::|||:|..|
Human   158 TGIFAYYQEAKSTNIMSSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLS 222

  Fly   214 TTGLELNNVALTGHSKPM-------HITPLANEGRQRYS 245
            :.|..::|.:|||.|:|.       |..||..:....||
Human   223 SQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 22/72 (31%)
E1-E2_ATPase 140..>230 CDD:278548 30/89 (34%)
ATP12ANP_001172014.1 ATPase-IIC_X-K 42..1045 CDD:273445 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.