DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ATP1A1

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_000692.2 Gene:ATP1A1 / 476 HGNCID:799 Length:1023 Species:Homo sapiens


Alignment Length:225 Identity:68/225 - (30%)
Similarity:114/225 - (50%) Gaps:19/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RKKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVL-P 83
            :|.|::|: :.:.:.|:.::.     |.....||..:...::|:||||..|...|||:|.|.| |
Human    24 KKGKKDRD-MDELKKEVSMDD-----HKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTP 82

  Fly    84 LPTKLELRPWI-FLKSCFSILGIIILLSSIASFAMYYLFAT--KTPDNGKVDPEFLVAGIILLVT 145
            .||..|   || |.:..|....:::.:.:|..|..|.:.|.  :.|.|     :.|..|::|...
Human    83 PPTTPE---WIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQN-----DNLYLGVVLSAV 139

  Fly   146 FFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMR 210
            ..:.|.....|......::.:|..::|....|||:|||..|..:::|.||.:.:|.|.|:|||:|
Human   140 VIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLR 204

  Fly   211 FFSTTGLELNNVALTGHSKPMHITP-LANE 239
            ..|..|.:::|.:|||.|:|...:| ..||
Human   205 IISANGCKVDNSSLTGESEPQTRSPDFTNE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 25/72 (35%)
E1-E2_ATPase 140..>230 CDD:278548 29/89 (33%)
ATP1A1NP_000692.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 3/15 (20%)
ATPase-IIC_X-K 30..1023 CDD:273445 66/219 (30%)
Phosphoinositide-3 kinase binding. /evidence=ECO:0000250 82..84 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..235 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S851
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.