DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and PMCA

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001014689.3 Gene:PMCA / 43787 FlyBaseID:FBgn0259214 Length:1255 Species:Drosophila melanogaster


Alignment Length:217 Identity:53/217 - (24%)
Similarity:94/217 - (43%) Gaps:44/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HELCARLEANVSQGLTSEAAGRKLARN--GKNVL-PLPTKLELR-PWIFLKSCFSILGIIILLSS 111
            ||||.:|..:.::||:...|..:..|.  |.||: |.|.|..|. .|..|:   .:..||:.:::
  Fly    40 HELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQ---DVTLIILEVAA 101

  Fly   112 IASFAMYY---------LFATKTPDNGKVDPEFLVAGII--LLVTFF--------LAGLTVQMQG 157
            :.|..:.:         :...:...:|.::...::..:|  ::||.|        ..||..:::|
  Fly   102 LVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEG 166

  Fly   158 DDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNV 222
            :..              .:|||.||...|...|::.||...:|||..||||.....:..|:::..
  Fly   167 EHK--------------FSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDES 217

  Fly   223 ALTGHS----KPMHITPLANEG 240
            :|||.|    |...:.|:...|
  Fly   218 SLTGESDHVKKGPDVDPMVLSG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 21/69 (30%)
E1-E2_ATPase 140..>230 CDD:278548 28/103 (27%)
PMCANP_001014689.3 ATPase-IIB_Ca 1..1057 CDD:273668 53/217 (24%)
Cation_ATPase_N 36..104 CDD:279080 20/66 (30%)
E1-E2_ATPase 172..448 CDD:278548 24/68 (35%)
Cation_ATPase 505..598 CDD:289987
HAD_like 676..807 CDD:119389
Cation_ATPase_C 873..1051 CDD:279079
ATP_Ca_trans_C 1096..1142 CDD:289209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.