DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and atp2b3a

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_005166875.1 Gene:atp2b3a / 436745 ZFINID:ZDB-GENE-040718-174 Length:1299 Species:Danio rerio


Alignment Length:205 Identity:50/205 - (24%)
Similarity:82/205 - (40%) Gaps:44/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LCARLEANVSQGLTSEAAGRKLARN--GKNVLPLP----TKLELRPWIFLKSCFSILGIIILLSS 111
            ||.||:.:.:.||:...|..:..|.  |.|.:| |    |.||| .|..|:   .|..||:.:::
Zfish    59 LCHRLKTSPADGLSDNPADLEKRRKVFGMNFIP-PKQPKTFLEL-VWEALQ---DITLIILEIAA 118

  Fly   112 IASFAMYYL------------FATKTPDNGKVDPEFLVAGIILLVTFFLAGLTV----------- 153
            |.|..:.:.            .:....|.|:.|..::....|||....:..:|.           
Zfish   119 IISLGLSFYQPPGGDSEACVEVSEGAEDEGEADANWIEGAAILLSVICVVLVTAFNDWSKEKQFR 183

  Fly   154 QMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLE 218
            .:|...:::...|          |:|:.....|...::|.||...:|||..||||........|:
Zfish   184 GLQSRIEQEQRFA----------VVRNSTVIQIPVAEMVVGDIAQVKYGDLLPADGVLIQGNDLK 238

  Fly   219 LNNVALTGHS 228
            ::..:|||.|
Zfish   239 IDESSLTGES 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 23/69 (33%)
E1-E2_ATPase 140..>230 CDD:278548 24/100 (24%)
atp2b3aXP_005166875.1 ATPase-IIB_Ca 23..1082 CDD:273668 50/205 (24%)
Cation_ATPase_N 57..116 CDD:279080 21/61 (34%)
E1-E2_ATPase 164..484 CDD:278548 21/95 (22%)
Cation_ATPase 545..634 CDD:289987
HAD 627..825 CDD:289480
Cation_ATPase_C 899..1077 CDD:279079
ATP_Ca_trans_C 1122..1198 CDD:289209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.