Sequence 1: | NP_001286728.1 | Gene: | CG45063 / 19835490 | FlyBaseID: | FBgn0266433 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005166875.1 | Gene: | atp2b3a / 436745 | ZFINID: | ZDB-GENE-040718-174 | Length: | 1299 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 50/205 - (24%) |
---|---|---|---|
Similarity: | 82/205 - (40%) | Gaps: | 44/205 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 LCARLEANVSQGLTSEAAGRKLARN--GKNVLPLP----TKLELRPWIFLKSCFSILGIIILLSS 111
Fly 112 IASFAMYYL------------FATKTPDNGKVDPEFLVAGIILLVTFFLAGLTV----------- 153
Fly 154 QMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLE 218
Fly 219 LNNVALTGHS 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG45063 | NP_001286728.1 | Cation_ATPase_N | 46..117 | CDD:214842 | 23/69 (33%) |
E1-E2_ATPase | 140..>230 | CDD:278548 | 24/100 (24%) | ||
atp2b3a | XP_005166875.1 | ATPase-IIB_Ca | 23..1082 | CDD:273668 | 50/205 (24%) |
Cation_ATPase_N | 57..116 | CDD:279080 | 21/61 (34%) | ||
E1-E2_ATPase | 164..484 | CDD:278548 | 21/95 (22%) | ||
Cation_ATPase | 545..634 | CDD:289987 | |||
HAD | 627..825 | CDD:289480 | |||
Cation_ATPase_C | 899..1077 | CDD:279079 | |||
ATP_Ca_trans_C | 1122..1198 | CDD:289209 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573941 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |