DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and SPoCk

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001262220.1 Gene:SPoCk / 40495 FlyBaseID:FBgn0052451 Length:1062 Species:Drosophila melanogaster


Alignment Length:184 Identity:49/184 - (26%)
Similarity:83/184 - (45%) Gaps:27/184 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ELCARLEANVSQGLTSEAAGRKLARNGKNVLPL----PTKLELRPW-IFLKSCFSILGIIILLSS 111
            |:..||:.:|..||....|..:....|.|.|.|    ||      | .:::...:.|.:::|.|:
  Fly   118 EVAGRLQVDVRTGLKWTEAKYRAKIIGHNELLLVAEDPT------WKKYIEQFRNPLILLLLGSA 176

  Fly   112 IASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCT 176
            :.|..|      |..|    |...:...|:::||      ...:|....|..|....:|:|..|.
  Fly   177 LVSVIM------KQFD----DAVSITIAILIVVT------VAFIQEYRSEKSLEELKKLVPPECH 225

  Fly   177 VIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNVALTGHSKP 230
            .:|:|..:....::|||||.:.:..|.|:|||:|.|....|.::..:.||.::|
  Fly   226 CLREGRLDTFLARELVPGDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 18/69 (26%)
E1-E2_ATPase 140..>230 CDD:278548 26/89 (29%)
SPoCkNP_001262220.1 ATPase-IIA2_Ca 110..1049 CDD:130585 49/184 (27%)
Cation_ATPase_N 112..179 CDD:279080 17/66 (26%)
E1-E2_ATPase 191..425 CDD:278548 27/95 (28%)
Cation_ATPase 496..579 CDD:289987
COG4087 <760..823 CDD:226572
Cation_ATPase_C 872..1044 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.