DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and atp2a2a

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_005166855.1 Gene:atp2a2a / 393940 ZFINID:ZDB-GENE-040426-702 Length:1042 Species:Danio rerio


Alignment Length:198 Identity:52/198 - (26%)
Similarity:92/198 - (46%) Gaps:15/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVLPLPTKLELRPW-IFLKSCFSILGIIILL 109
            |.....|:.:....|.|.|||.:...|...:.|.|.||......:  | :.::....:|..|:||
Zfish     5 HTKSVEEVYSNFSVNESTGLTLDQVKRNRDKWGPNELPAEEGKSI--WELVIEQFEDLLVRILLL 67

  Fly   110 SSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMY 174
            ::..||.:.:....:......|:| |::  :::|:...:.|:   .|..:.|:.:.|..|..|..
Zfish    68 AACISFVLAWFEEGEETITAFVEP-FVI--LLILIANAIVGV---WQERNAENAIEALKEYEPEM 126

  Fly   175 CTVIRDGEKEV--IRTQDLVPGDTLPIKYGQRLPADMRF--FSTTGLELNNVALTGHSKPM--HI 233
            ..|.|...|.|  |:.:|:||||.:.:..|.::|||:|.  ..:|.|.::...|||.|..:  |.
Zfish   127 GKVYRQDRKSVQRIKAKDIVPGDIVEVAVGDKVPADIRISAIKSTTLRVDQSILTGESVSVIKHT 191

  Fly   234 TPL 236
            .|:
Zfish   192 DPV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 19/71 (27%)
E1-E2_ATPase 140..>230 CDD:278548 28/93 (30%)
atp2a2aXP_005166855.1 Cation_ATPase_N 4..72 CDD:279080 17/68 (25%)
ATPase-IIA1_Ca 53..987 CDD:273452 39/148 (26%)
E1-E2_ATPase 93..340 CDD:278548 30/107 (28%)
Cation_ATPase 419..526 CDD:289987
HAD <604..710 CDD:289480
Cation_ATPase_C 782..985 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.