Sequence 1: | NP_001286728.1 | Gene: | CG45063 / 19835490 | FlyBaseID: | FBgn0266433 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005166855.1 | Gene: | atp2a2a / 393940 | ZFINID: | ZDB-GENE-040426-702 | Length: | 1042 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 52/198 - (26%) |
---|---|---|---|
Similarity: | 92/198 - (46%) | Gaps: | 15/198 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 HIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVLPLPTKLELRPW-IFLKSCFSILGIIILL 109
Fly 110 SSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMY 174
Fly 175 CTVIRDGEKEV--IRTQDLVPGDTLPIKYGQRLPADMRF--FSTTGLELNNVALTGHSKPM--HI 233
Fly 234 TPL 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG45063 | NP_001286728.1 | Cation_ATPase_N | 46..117 | CDD:214842 | 19/71 (27%) |
E1-E2_ATPase | 140..>230 | CDD:278548 | 28/93 (30%) | ||
atp2a2a | XP_005166855.1 | Cation_ATPase_N | 4..72 | CDD:279080 | 17/68 (25%) |
ATPase-IIA1_Ca | 53..987 | CDD:273452 | 39/148 (26%) | ||
E1-E2_ATPase | 93..340 | CDD:278548 | 30/107 (28%) | ||
Cation_ATPase | 419..526 | CDD:289987 | |||
HAD | <604..710 | CDD:289480 | |||
Cation_ATPase_C | 782..985 | CDD:279079 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573935 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |