DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp13a2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006239308.1 Gene:Atp13a2 / 362645 RGDID:1307977 Length:1173 Species:Rattus norvegicus


Alignment Length:261 Identity:57/261 - (21%)
Similarity:102/261 - (39%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SKWRGRWCRSRRKKKEE--RESLQQTENELWLEYFSPY--LHIWPFHELCARLEANVSQGLTSEA 69
            |.|:......|:|:.::  |..:.|.:..:|:|....:  :.:......|..:..: |.||:.:.
  Rat   140 SMWQDTTQLHRQKEAKQVLRYYILQGQRYVWMETQQAFCQVSLLDHGRACDDIHCS-SSGLSLQD 203

  Fly    70 AGRKLARNGKNVLPLPTKL--------ELRPWIFLKSCFSILGIIILLSSIASFAMYYLFATKTP 126
            ...:....|.||:.:|.|.        .|.|:.    .|....|.:.|:.     .||.:|... 
  Rat   204 QAVRKTIYGPNVIGIPVKSYLQLLVDEALNPYY----GFQAFSIALWLAD-----HYYWYAVCI- 258

  Fly   127 DNGKVDPEFLVAGIILLVTFF-----------LAGLTVQMQGDDDEDMLIAFDELMPMYCTVIR- 179
                    ||::.|.:.::.:           :..|:|::|                    |.| 
  Rat   259 --------FLISAISICLSLYKTRKQSMTLRDMVKLSVRVQ--------------------VCRP 295

  Fly   180 DGEKEVIRTQDLVPGDTLPI-KYGQRLPADMRFFSTTGLELNNVALTGHSKPMHITPLANEGRQR 243
            .||:|.:.:.:|||||.|.: :.|..:|.|....:...: :|..:|||.|.|:..|.|. ||.|.
  Rat   296 GGEEEWVDSSELVPGDCLVLPQEGGMMPCDAALVAGECV-VNESSLTGESIPVLKTALP-EGPQP 358

  Fly   244 Y 244
            |
  Rat   359 Y 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 14/78 (18%)
E1-E2_ATPase 140..>230 CDD:278548 23/102 (23%)
Atp13a2XP_006239308.1 P-ATPase-V 39..1116 CDD:273738 57/261 (22%)
P5-ATPase 39..>110 CDD:289194
E1-E2_ATPase 258..493 CDD:278548 32/133 (24%)
Cation_ATPase <621..658 CDD:289987
COG4087 <843..>892 CDD:226572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.