DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and CG6230

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_609490.1 Gene:CG6230 / 34546 FlyBaseID:FBgn0027582 Length:1225 Species:Drosophila melanogaster


Alignment Length:273 Identity:59/273 - (21%)
Similarity:95/273 - (34%) Gaps:108/273 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YLHI-------WPFHEL----CARLE---ANVSQGLTSEAAGRKLAR------NGKN-VLPL-PT 86
            :|||       |..|.|    |.|::   |||            ||:      ||.: ::|: .:
  Fly   116 FLHILTLLFCYWSVHVLAFLTCRRVKLPGANV------------LAKVVPTPNNGNSKIVPIRSS 168

  Fly    87 KLE----LRPWIFLKSC--------------FSILGIIILLSSIASFAMY--YLFATKTPDNGKV 131
            |||    ...::|.|:.              |.:.|::...||.......  ...||:|..|.::
  Fly   169 KLEDGSTQYYFVFQKTKYVWNEDRKTFRAVEFPVNGLLSTYSSSRGLETEEDIKRATQTYGNNEM 233

  Fly   132 D---PEF------LVAGIILLVTFFLAGLTVQMQGDDDE--------DMLIAFDELMPMYCTVIR 179
            :   |||      .......:...|..||...    ||.        .|||||:      ||:::
  Fly   234 EMVVPEFHELFIERATAPFFVFQVFSVGLWCM----DDYWYYSLFTLFMLIAFE------CTIVK 288

  Fly   180 D-----------GEKEV------------IRTQDLVPGDTLPIKYGQR---LPADMRFFSTTGLE 218
            .           |.|..            :.:.:|:|||.:.|...|.   :|.|:.....:.: 
  Fly   289 QQLRNMSEIRKMGNKPYLIYAFRQNKWRHLGSDELLPGDLVSITRSQNDNIVPCDLVILRGSCI- 352

  Fly   219 LNNVALTGHSKPM 231
            ::...|||.|.|:
  Fly   353 VDESMLTGESVPL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 24/110 (22%)
E1-E2_ATPase 140..>230 CDD:278548 26/123 (21%)
CG6230NP_609490.1 P-ATPase-V 109..1193 CDD:273738 59/273 (22%)
E1-E2_ATPase 310..515 CDD:278548 13/57 (23%)
Cation_ATPase <590..664 CDD:289987
COG4087 <850..901 CDD:226572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.