DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ATP7

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001259466.1 Gene:ATP7 / 32142 FlyBaseID:FBgn0030343 Length:1254 Species:Drosophila melanogaster


Alignment Length:193 Identity:48/193 - (24%)
Similarity:73/193 - (37%) Gaps:48/193 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LCARLEANVSQGLTSEA---AGR-KLARNGKNVLPLPTKLELRPW--IFLKSCFSILGIIILLSS 111
            :|..:||     |..||   .|| |:|.|     .|..|.|:|.|  .||.|        ::...
  Fly   338 ICEAIEA-----LGFEAKLMTGRDKMAHN-----YLEHKEEIRKWRNAFLVS--------LIFGG 384

  Fly   112 IASFAMYYLFATKTPDNGKVDPEFLVAGIIL--LVTF-------FLAGLTVQMQ-------GDDD 160
            ....||.| |..:..|.|..:...||.|:.:  ||.|       |..|....:|       |..:
  Fly   385 PCMVAMIY-FMLEMSDKGHANMCCLVPGLSMENLVMFLLSTPVQFFGGFHFYVQSYRAIKHGTTN 448

  Fly   161 EDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNVA 223
            .|:||:      |..|:.......|:....|:..::.|:.:.. .|..:..|.:.|..|.::|
  Fly   449 MDVLIS------MVTTISYVYSVAVVIAAVLLEQNSSPLTFFD-TPPMLLIFISLGRWLEHIA 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 19/69 (28%)
E1-E2_ATPase 140..>230 CDD:278548 20/100 (20%)
ATP7NP_001259466.1 HMA 16..78 CDD:238219
HMA 97..159 CDD:238219
HMA 214..274 CDD:238219
ZntA 285..1131 CDD:225127 48/193 (25%)
HMA 287..350 CDD:238219 5/16 (31%)
E1-E2_ATPase 489..735 CDD:278548 4/16 (25%)
COG4087 <984..1085 CDD:226572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.