DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp13a5

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_038944228.1 Gene:Atp13a5 / 303856 RGDID:1306792 Length:1237 Species:Rattus norvegicus


Alignment Length:214 Identity:48/214 - (22%)
Similarity:83/214 - (38%) Gaps:50/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HIWPF-------------HELCARLEANVSQGLTSEAAGRKLARNGKNVLPLPTKLELRP-WIFL 96
            ::|.|             ...|..:......|||||....:....|.|.:    ::|::| |   
  Rat   139 YVWDFLKKRFQKVGLLEDSNSCFDIHHTFGLGLTSEEQEVRRLVCGPNAI----EVEIQPIW--- 196

  Fly    97 KSCFSILGIIILLSSIASFAMYYLFATKT----PDNGKVDPEFLVAGIILLVTFFLAGLTVQMQG 157
                     .:|:..:.:  .:|:|...|    ...|.:  |:.||.|||.|      :::.:..
  Rat   197 ---------KLLVKQVLN--PFYVFQAFTLTLWLSQGYI--EYSVAIIILTV------ISIVLSV 242

  Fly   158 DDDEDMLIAFDELMPMYCTV-----IRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFSTTGL 217
            .|.....:...:|:..:..|     :||...:.:.::.|||||.|.:.....||.|......:.:
  Rat   243 YDLRQQSVKLHKLVEDHNKVQVTITVRDKGLQELESRLLVPGDILILPGKISLPCDAVLIDGSCV 307

  Fly   218 ELNNVALTGHSKPMHITPL 236
             :|...|||.|.|:..|||
  Rat   308 -VNEGMLTGESIPVTKTPL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 14/84 (17%)
E1-E2_ATPase 140..>230 CDD:278548 23/94 (24%)
Atp13a5XP_038944228.1 P5-ATPase 23..142 CDD:403569 0/2 (0%)
P-type_ATPase_cation 174..1020 CDD:319842 41/179 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.