Sequence 1: | NP_001286728.1 | Gene: | CG45063 / 19835490 | FlyBaseID: | FBgn0266433 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104293.1 | Gene: | Atp2a2 / 29693 | RGDID: | 2174 | Length: | 1043 | Species: | Rattus norvegicus |
Alignment Length: | 200 | Identity: | 58/200 - (28%) |
---|---|---|---|
Similarity: | 93/200 - (46%) | Gaps: | 19/200 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 HIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVLPL---PTKLELRPWIFLKSCFSILGIII 107
Fly 108 LLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMP 172
Fly 173 MYCTVIRDGEKEV--IRTQDLVPGDTLPIKYGQRLPADMRFFS--TTGLELNNVALTGHSKPM-- 231
Fly 232 HITPL 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG45063 | NP_001286728.1 | Cation_ATPase_N | 46..117 | CDD:214842 | 22/73 (30%) |
E1-E2_ATPase | 140..>230 | CDD:278548 | 31/93 (33%) | ||
Atp2a2 | NP_001104293.1 | Cation_ATPase_N | 4..72 | CDD:279080 | 20/70 (29%) |
ATPase-IIA1_Ca | 53..988 | CDD:273452 | 42/147 (29%) | ||
E1-E2_ATPase | 93..340 | CDD:278548 | 33/106 (31%) | ||
Cation_ATPase | 419..527 | CDD:289987 | |||
Interaction with HAX1. /evidence=ECO:0000250 | 575..594 | ||||
HAD | <605..711 | CDD:289480 | |||
Cation_ATPase_C | 783..986 | CDD:279079 | |||
Interaction with PLN. /evidence=ECO:0000250|UniProtKB:P04191 | 787..807 | ||||
Interaction with TMEM64 and PDIA3. /evidence=ECO:0000250|UniProtKB:O55143 | 788..1043 | ||||
Interaction with PLN. /evidence=ECO:0000250|UniProtKB:P04191 | 931..942 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334730 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |