DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp1a4

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001257959.1 Gene:Atp1a4 / 29132 RGDID:61952 Length:1028 Species:Rattus norvegicus


Alignment Length:225 Identity:67/225 - (29%)
Similarity:109/225 - (48%) Gaps:19/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVL-PL 84
            |.|..::.|::.:.|:.::.     |.....||.|:...::::||:...|...|..||.||| |.
  Rat    29 KVKRRKKDLEELKKEVVMDD-----HKLTLDELSAKYSVDLTKGLSVTDAQEILTLNGPNVLTPP 88

  Fly    85 PTKLELRPWI-FLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFL 148
            ||..|   || |.|..|....:::...|:..|..|.:..:...:|...|..:|  ||:|.....:
  Rat    89 PTTPE---WIKFCKQLFGGFSLLLWTGSLLCFLAYGIHVSYYQENANKDNLYL--GIVLSAVVII 148

  Fly   149 AGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFS 213
            .|.....|......::.:|..::|....|||||||..|..:|:|.||.:.:|.|.::|||:|..:
  Rat   149 TGCFSYYQEAKSSKIMESFKTMVPQQALVIRDGEKMQINVRDVVLGDLVEVKGGDQVPADIRVIA 213

  Fly   214 TTGLELNNVALTGHSKPM-------HITPL 236
            ..|.:::|.:|||.|:|.       |..||
  Rat   214 AQGCKVDNSSLTGESEPQSRCPDCTHENPL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 24/72 (33%)
E1-E2_ATPase 140..>230 CDD:278548 30/89 (34%)
Atp1a4NP_001257959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 2/6 (33%)
ATPase-IIC_X-K 32..1028 CDD:273445 65/222 (29%)
Cation_ATPase_N 46..119 CDD:214842 24/80 (30%)
Interaction with phosphoinositide-3 kinase. /evidence=ECO:0000250 87..89 1/1 (100%)
E1-E2_ATPase 140..371 CDD:278548 34/104 (33%)
Cation_ATPase 434..526 CDD:289987
COG4087 608..757 CDD:226572
Cation_ATPase_C 804..1013 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.