DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp1a4

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_038762.1 Gene:Atp1a4 / 27222 MGIID:1351335 Length:1032 Species:Mus musculus


Alignment Length:225 Identity:65/225 - (28%)
Similarity:108/225 - (48%) Gaps:19/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVL-PL 84
            |.|..::.|::.:.|:.::.     |.....||.|:...::::||:...|...|.:||.||| |.
Mouse    33 KMKRRKKDLEELKKEVVMDD-----HKLTLDELSAKYSVDLTKGLSILEAQDILFQNGPNVLTPP 92

  Fly    85 PTKLELRPWI-FLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFL 148
            ||..|   |: |.:..|....:::...:...|..|.:......:|...|..:|  ||:|.....:
Mouse    93 PTTPE---WVKFCRQLFGGFSLLLWTGACLCFLAYGIHVNYYKENANKDNLYL--GIVLSAVVII 152

  Fly   149 AGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFS 213
            .|.....|......::.:|..::|....|||||||..|..:|:|.||.:.:|.|.::|||:|..|
Mouse   153 TGCFSYYQEAKSSKIMESFKNMVPQQALVIRDGEKMQINVRDVVLGDLVEVKGGDQIPADIRVIS 217

  Fly   214 TTGLELNNVALTGHSKPM-------HITPL 236
            ..|.:::|.:|||.|:|.       |..||
Mouse   218 AQGCKVDNSSLTGESEPQSRCPDCTHENPL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 21/72 (29%)
E1-E2_ATPase 140..>230 CDD:278548 31/89 (35%)
Atp1a4NP_038762.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 2/8 (25%)
ATPase-IIC_X-K 36..1032 CDD:273445 63/222 (28%)
Cation_ATPase_N 50..123 CDD:214842 21/80 (26%)
Interaction with phosphoinositide-3 kinase. /evidence=ECO:0000250 91..93 1/1 (100%)
E1-E2_ATPase 144..375 CDD:278548 35/104 (34%)
Cation_ATPase 438..530 CDD:289987
COG4087 <696..761 CDD:226572
Cation_ATPase_C 808..1017 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.