DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp4a

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_036641.1 Gene:Atp4a / 24216 RGDID:2177 Length:1034 Species:Rattus norvegicus


Alignment Length:237 Identity:62/237 - (26%)
Similarity:104/237 - (43%) Gaps:22/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRWCRSRRKKK------EERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAG 71
            |.......|||      :::|.|:..:.|:.:..     |.....||..:.:.:.::||.:..|.
  Rat    20 GNMAAKMSKKKAGGGGGKKKEKLENMKKEMEMND-----HQLSVSELEQKYQTSATKGLKASLAA 79

  Fly    72 RKLARNGKNVLPLPTKLELRPWIFLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFL 136
            ..|.|:|.|.|..|....    .::|....:.|.:..|..:|:......||.:..:......:.|
  Rat    80 ELLLRDGPNALRPPRGTP----EYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDNL 140

  Fly   137 VAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKY 201
            ...:.|:....:.|.....|.....:::.:|..|:|...||||||:|..|....||.||.:.:|.
  Rat   141 YLALALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKG 205

  Fly   202 GQRLPADMRFFSTTGLELNNVALTGHSKPM-------HITPL 236
            |.|:|||:|..|..|.:::|.:|||.|:|.       |.:||
  Rat   206 GDRVPADIRILSAQGCKVDNSSLTGESEPQTRSPECTHESPL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 16/70 (23%)
E1-E2_ATPase 140..>230 CDD:278548 32/89 (36%)
Atp4aNP_036641.1 H-K_ATPase_N 2..>27 CDD:286172 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..40 4/19 (21%)
ATPase-IIC_X-K 42..1034 CDD:273445 57/215 (27%)
Cation_ATPase_N 50..124 CDD:214842 16/82 (20%)
E1-E2_ATPase 145..375 CDD:278548 36/103 (35%)
Cation_ATPase 437..531 CDD:289987
COG4087 <687..>742 CDD:226572
Cation_ATPase_C 809..1018 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.