DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp2b2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_036640.1 Gene:Atp2b2 / 24215 RGDID:2176 Length:1198 Species:Rattus norvegicus


Alignment Length:209 Identity:53/209 - (25%)
Similarity:85/209 - (40%) Gaps:52/209 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LCARLEANVSQGLTSEAAGRKLARN--GKNVLPLPTKLELRPWIFLKSCFSILG----IIILLSS 111
            :|.||:.:..:||...|...:..:.  |:|.:| |.|    |..||:..:..|.    ||:.:::
  Rat    56 ICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIP-PKK----PKTFLQLVWEALQDVTLIILEIAA 115

  Fly   112 IASFAMYYLF---------ATK---TPDNGKVDPEFLVAGIIL-------LVTFF--------LA 149
            |.|..:.:..         ||.   ..|.|:.:..::....||       |||.|        ..
  Rat   116 IISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR 180

  Fly   150 GLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRFFST 214
            ||..:::.:..              .||:|.|:...|...::|.||...||||..||||..|...
  Rat   181 GLQSRIEQEQK--------------FTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQG 231

  Fly   215 TGLELNNVALTGHS 228
            ..|:::..:|||.|
  Rat   232 NDLKIDESSLTGES 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 19/69 (28%)
E1-E2_ATPase 140..>230 CDD:278548 30/104 (29%)
Atp2b2NP_036640.1 ATPase-IIB_Ca 12..1042 CDD:273668 53/209 (25%)
Cation_ATPase_N 51..113 CDD:279080 17/61 (28%)
E1-E2_ATPase 161..443 CDD:278548 28/99 (28%)
Cation_ATPase 504..593 CDD:289987
HAD <645..784 CDD:289480
Cation_ATPase_C 858..1036 CDD:279079
ATP_Ca_trans_C 1081..1128 CDD:289209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.