DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp1a2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_036637.1 Gene:Atp1a2 / 24212 RGDID:2168 Length:1020 Species:Rattus norvegicus


Alignment Length:219 Identity:66/219 - (30%)
Similarity:113/219 - (51%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVL-PL 84
            |||::.:.|.:.:.|:.::.     |.....||..:.:.::|:|||::.|...|||:|.|.| |.
  Rat    22 KKKQKEKELDELKKEVAMDD-----HKLSLDELGRKYQVDLSKGLTNQRAQDILARDGPNALTPP 81

  Fly    85 PTKLELRPWI-FLKSCFSILGIIILLSSIASFAMYYLFAT--KTPDNGKVDPEFLVAGIILLVTF 146
            ||..|   |: |.:..|....|::.:.::..|..|.:.|.  ..|.|     :.|..||:|....
  Rat    82 PTTPE---WVKFCRQLFGGFSILLWIGALLCFLAYGILAAMEDEPSN-----DNLYLGIVLAAVV 138

  Fly   147 FLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRF 211
            .:.|.....|......::.:|..::|....|||:|||..|..:::|.||.:.:|.|.|:|||:|.
  Rat   139 IVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRI 203

  Fly   212 FSTTGLELNNVALTGHSKPMHITP 235
            .|:.|.:::|.:|||.|:|...:|
  Rat   204 ISSHGCKVDNSSLTGESEPQTRSP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 23/72 (32%)
E1-E2_ATPase 140..>230 CDD:278548 30/89 (34%)
Atp1a2NP_036637.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 3/8 (38%)
ATPase-IIC_X-K 30..1020 CDD:273445 63/211 (30%)
Interaction with phosphoinositide-3 kinase. /evidence=ECO:0000250 80..82 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..231 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.