DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp2c1

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001240760.1 Gene:Atp2c1 / 235574 MGIID:1889008 Length:952 Species:Mus musculus


Alignment Length:241 Identity:62/241 - (25%)
Similarity:101/241 - (41%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRKKKEER----ESLQQTENELWLEYF-SPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNG 78
            |.::.||:    :.:...|||..:... |.........|:...|:|::..||.......:.|.:|
Mouse    29 RSQRAEEQVARFQKIPNVENETMIPVLTSKRASELAVSEVAGLLQADLQNGLNKSEVSHRRAFHG 93

  Fly    79 KNVLPLPTKLELRPWIFLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILL 143
            .|...:.....|  |....|.|....|::||:|.....:...|.         |...:...|:::
Mouse    94 WNEFDISEDEPL--WKKYISQFKNPLIMLLLASAVISILMRQFD---------DAVSITVAIVIV 147

  Fly   144 VTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPAD 208
            ||      ...:|....|..|....:|:|..|..:|:|:.|....:|||||||:.:..|.|:|||
Mouse   148 VT------VAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPAD 206

  Fly   209 MRFFSTTGLELNNVALTGHSKP-MHIT---PLANEGRQRYSRIEYI 250
            :|.|....|.::..:|||.:.| ..:|   |.||......|.|.::
Mouse   207 LRLFEAVDLSVDESSLTGETAPCSKVTAPQPAANGDLASRSNIAFM 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 16/70 (23%)
E1-E2_ATPase 140..>230 CDD:278548 30/89 (34%)
Atp2c1NP_001240760.1 ATPase-IIA2_Ca 57..936 CDD:130585 56/213 (26%)
Cation_ATPase_N 60..128 CDD:279080 16/69 (23%)
E1-E2_ATPase 152..372 CDD:278548 34/101 (34%)
Cation_ATPase 443..526 CDD:289987
COG4087 589..712 CDD:226572
Cation_ATPase_C 759..931 CDD:279079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.