DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and ATP13A2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_005245867.1 Gene:ATP13A2 / 23400 HGNCID:30213 Length:1201 Species:Homo sapiens


Alignment Length:255 Identity:60/255 - (23%)
Similarity:100/255 - (39%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRW-CRSRRKKKEERESLQQTENELWLEYFSPYLHIW-----PFHEL--------CARLEANVSQ 63
            |.| ..::..|.||..|:.|.....:|  |....:||     .|:::        |..:..: ..
Human   140 GAWKDTAQLHKSEEAVSVGQRVLRYYL--FQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRS-RH 201

  Fly    64 GLTSEAAGRKLARNGKNVLPLPTKL--------ELRPWIFLKSCFSILGIIILLSSIASFAMYYL 120
            ||:.:....:.|..|.||:.:|.|.        .|.|:.    .|....|.:.|:.     .||.
Human   202 GLSLQDQMVRKAIYGPNVISIPVKSYPQLLVDEALNPYY----GFQAFSIALWLAD-----HYYW 257

  Fly   121 FATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEV 185
            :|...         ||::.|.:.::.:    ..:.|.....||:    :|....|.....||:|.
Human   258 YALCI---------FLISSISICLSLY----KTRKQSQTLRDMV----KLSMRVCVCRPGGEEEW 305

  Fly   186 IRTQDLVPGDTLPI-KYGQRLPADMRFFSTTGLELNNVALTGHSKPMHITPLANEGRQRY 244
            :.:.:|||||.|.: :.|..:|.|....:...: :|..:|||.|.|:..|.|. ||...|
Human   306 VDSSELVPGDCLVLPQEGGLMPCDAALVAGECM-VNESSLTGESIPVLKTALP-EGLGPY 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 17/91 (19%)
E1-E2_ATPase 140..>230 CDD:278548 23/90 (26%)
ATP13A2XP_005245867.1 P-ATPase-V 39..1077 CDD:273738 60/255 (24%)
P5-ATPase 39..>114 CDD:289194
E1-E2_ATPase 262..497 CDD:278548 31/121 (26%)
Cation_ATPase <627..663 CDD:289987
COG4087 <849..>898 CDD:226572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.