DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp1a3

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_011248820.1 Gene:Atp1a3 / 232975 MGIID:88107 Length:1066 Species:Mus musculus


Alignment Length:219 Identity:68/219 - (31%)
Similarity:108/219 - (49%) Gaps:13/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRKKKEERESLQQTENELWLEYFSPYLHIWPFHELCARLEANVSQGLTSEAAGRKLARNGKNVL- 82
            ::.|.:||..|...:.|:.:..     |.....|:|.:...:..||||...|...|||:|.|.| 
Mouse    25 KKSKAKERRDLDDLKKEVAMTE-----HKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALT 84

  Fly    83 PLPTKLELRPWI-FLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTF 146
            |.||..|   |: |.:..|....|::.:.:|..|..|.:.| .|.|:...|..:|  ||:|....
Mouse    85 PPPTTPE---WVKFCRQLFGGFSILLWIGAILCFLAYGIQA-GTEDDPSGDNLYL--GIVLAAVV 143

  Fly   147 FLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVIRTQDLVPGDTLPIKYGQRLPADMRF 211
            .:.|.....|......::.:|..::|....|||:|||..:..:::|.||.:.||.|.|:|||:|.
Mouse   144 IITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRI 208

  Fly   212 FSTTGLELNNVALTGHSKPMHITP 235
            .|..|.:::|.:|||.|:|...:|
Mouse   209 ISAHGCKVDNSSLTGESEPQTRSP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 24/72 (33%)
E1-E2_ATPase 140..>230 CDD:278548 30/89 (34%)
Atp1a3XP_011248820.1 ATPase-IIC_X-K 31..1018 CDD:273445 67/213 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.