DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and Atp13a3

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001121568.1 Gene:Atp13a3 / 224088 MGIID:2685387 Length:1249 Species:Mus musculus


Alignment Length:254 Identity:61/254 - (24%)
Similarity:103/254 - (40%) Gaps:51/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CRSRRKKKEERESLQQTENELWLEYFSPYLHIWPFHE------LCARLEANVSQGLTSEA-AGRK 73
            |...:..:.:.:.::...:.....:::..:|.:.|.:      .||.|....|.|||... |.||
Mouse   120 CEMNKYSQSQSQQMRYFTHHSIRYFWNDAIHNFDFLKGLDEGVSCASLYEKHSAGLTQGMHAYRK 184

  Fly    74 L-------ARNGKNVLPLPTKLELRPWIFLKSCFSILGIIILLSSIASFAMYYLFATKTPDNGKV 131
            |       |....:|..|..|..|.|: ::...||::        :.|...||.:|         
Mouse   185 LIYGVNEIAVKVPSVFKLLIKEVLNPF-YIFQLFSVI--------LWSVDEYYYYA--------- 231

  Fly   132 DPEFLVAGIILLVTFFLAGL-TVQMQGDDDEDMLIAFDELMPMYCTVIRDGEK-EVIRTQDLVPG 194
                 :|.:|:.|...::.| :::.|.....||:.....:....|   |:.|: |.|.:.|||||
Mouse   232 -----LAIVIMSVVSIISSLYSIRKQYVMLHDMVATHSTVRVSVC---RENEEIEEIFSTDLVPG 288

  Fly   195 DTLPIKY-GQRLPADMRFFSTTGLELNNVALTGHSKPMHITPLANE-------GRQRYS 245
            |.:.|.. |..:|.|....:.|.: :|...|||.|.|:..|.|.|.       |.::||
Mouse   289 DVMIIPLNGTVMPCDAVLINGTCI-VNESMLTGESVPVTKTNLPNPSVDVKGMGEEQYS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 22/84 (26%)
E1-E2_ATPase 140..>230 CDD:278548 27/92 (29%)
Atp13a3NP_001121568.1 P-ATPase-V 14..1142 CDD:273738 61/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.