DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and CG45062

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001286726.1 Gene:CG45062 / 19835139 FlyBaseID:FBgn0266432 Length:794 Species:Drosophila melanogaster


Alignment Length:167 Identity:40/167 - (23%)
Similarity:66/167 - (39%) Gaps:36/167 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LHIWPFHELCARLEANVS---------QGLTSEAAGRKLARNGKNVLPLPTKLELRPWIFLKSCF 100
            || | ..:.|.||.|.||         ..:.|...|  :|:.|..|: .....:|   |.|.:.|
  Fly   468 LH-W-IADACRRLGAVVSVIGGTLHDTPAMRSSHVG--VAKYGSAVM-CEASADL---ILLDTSF 524

  Fly   101 ----SILGIIILLSSIASFAMYYLFATKTPDNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDE 161
                |::|...||......|:.|..||.            :..|::.:.|||.|:.:.:...|  
  Fly   525 ATLVSVVGDSRLLFENLKKALAYCLATN------------ICNILVYLFFFLLGIPLYIHIMD-- 575

  Fly   162 DMLIAF-DELMPMYCTVIRDGEKEVIRTQDLVPGDTL 197
            ::::|| ..|:|....:....|:.::.....|..|.|
  Fly   576 ELILAFLVNLVPALTLIYEPPEENLMLQMPKVYDDFL 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 21/83 (25%)
E1-E2_ATPase 140..>230 CDD:278548 14/59 (24%)
CG45062NP_001286726.1 E1-E2_ATPase <13..132 CDD:278548
Cation_ATPase 190..284 CDD:289987
Cation_ATPase_C 582..777 CDD:295563 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.