DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45063 and catp-2

DIOPT Version :9

Sequence 1:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_504328.1 Gene:catp-2 / 182114 WormBaseID:WBGene00015338 Length:1050 Species:Caenorhabditis elegans


Alignment Length:240 Identity:61/240 - (25%)
Similarity:115/240 - (47%) Gaps:25/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLCFKRISKWRGRWCRSRRKKKEERESLQQTENELWLEYFSPYLHIWPFHELCAR-----LEAN 60
            |.|.| .:.:|..|...:...|.:..:.:.|  ..|.|.:...:|.:....|..:.     ::..
 Worm     1 MTLLF-GVKRWLRRGDEASDSKADASKEVNQ--QNLSLSFNEHHLDMRQLSEKFSMSKLDIVDPK 62

  Fly    61 VSQGLTSEAAGRKLARNGKNVLPLPTKLELRPW-IFLKSCFSILGIIILLSSIASFAMYYLFATK 124
            ||:||:.:.|..:|..:|:|.|. |.|: :..| :||:...::|.|::..::..|...|.     
 Worm    63 VSRGLSKQVAAERLESDGRNALS-PPKV-ISNWKLFLRQFKNLLWILMFGAAALSLVAYI----- 120

  Fly   125 TPDNGKVDPEFLV---AGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEVI 186
                  .||..|.   .||.::|..|:..:....:.....:::.||..|||:.|.|||||.::.:
 Worm   121 ------YDPSDLTNLCVGIFIIVIIFVMCIVSFFEEKKGVEVVRAFQSLMPLSCQVIRDGVEQTL 179

  Fly   187 RTQDLVPGDTLPIKYGQRLPADMRFFSTTGLELNNVALTGHSKPM 231
            ..::||.||.:.::.|.::|||:|..:.|...|...::||.::|:
 Worm   180 NPEELVVGDIVVVRSGCKVPADIRVIACTDFYLETSSITGEAEPL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 18/76 (24%)
E1-E2_ATPase 140..>230 CDD:278548 27/89 (30%)
catp-2NP_504328.1 HAD_like 66..1040 CDD:389748 48/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.